PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000036G1110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 404aa    MW: 42385.4 Da    PI: 5.0425
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000036G1110genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.15e-18320353134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++C+  kTp+WR gp g+ktLCnaCG++y++ +
  PH01000036G1110 320 CTHCQIEKTPQWRAGPLGPKTLCNACGVRYKSGR 353
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.66E-14313376No hitNo description
PROSITE profilePS5011411.213314350IPR000679Zinc finger, GATA-type
SMARTSM004017.6E-16314364IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.2E-14318351IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.72E-14319376No hitNo description
PROSITE patternPS003440320345IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15320353IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MASGGFLEEM MREQSLLEAT CGDLFDHIDD LLDFPKEDSA DDVLLLDAPA PGSPLSARII  60
DVGYGKPAPP PLVAPPPAQG DAAFFDAQGA LGAEAFDGKN GHIGSCDELD MDMAQLEWLS  120
ELFDDTSIPH EPAFPGASCP APIKASALAA NAGVVLPDKM EDALFRSSSP ISVLEHNSFN  180
AANNGGSSSA SSSSSASSSS ESFSGSGRAW SAPAPPVLVI PARARSKRSR PSAFTAVRAA  240
APAEETTILV PTPMYSSTSS HSDPESIAES NPHPPPMKKK KAKKPRATAV ASDADAEADA  300
DADYEEGGAH ALPPGAVRRC THCQIEKTPQ WRAGPLGPKT LCNACGVRYK SGRLFPEYRP  360
AASPTFVPSI HSNSHKKVVE MRQKVVRNGD PSCDLLQYIR RGD*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00047PBMTransfer from AT1G08000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954284.10.0PREDICTED: GATA transcription factor 8-like
RefseqXP_004954283.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLI1P5C20.0I1P5C2_ORYGL; Uncharacterized protein
STRINGORGLA02G0317800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51693451
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-37GATA family protein